PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn311481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 525aa    MW: 58241.9 Da    PI: 6.2667
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn311481genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.43.4e-28194247154
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                 k rl+W++eLH++Fv+a+eqLGG  kA+Pk+ile+m+v+gL++e+v+SHLQk+R
  Achn311481 194 KHRLVWSKELHNKFVDALEQLGGGSKAVPKKILEVMNVPGLSRENVASHLQKFR 247
                 68**************************************************** PP

2Response_reg80.74.9e-27291371109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + ++l+ ++l k +y +v+++++++eale+l++++  +Dl+++D+em +mdG++ll++i  e  ++p+i+++a+++ e + + ++ Ga 
    Achn311481  29 VLAVDDNVVCLKLIVTLLIKCRY-KVTATTKPTEALEMLRKNKesYDLVITDVEMLDMDGFQLLQTIGIEM-DVPVIMISANDDTESVMKGVRHGAL 123
                   799********************.***************888889**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel +
    Achn311481 124 DYLVKPVRIEELKN 137
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521727.12E-3425150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.9E-3926179No hitNo description
SMARTSM004482.0E-2927139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.21128143IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.7E-2329137IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.04E-2830142No hitNo description
PROSITE profilePS5129414.043191251IPR017930Myb domain
SuperFamilySSF466898.24E-18192252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-26192251IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-24194248IPR006447Myb domain, plants
PfamPF002491.7E-7197246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MSVNDQDLAN PNPYLEINAK TDFPEGLRVL AVDDNVVCLK LIVTLLIKCR YKVTATTKPT  60
EALEMLRKNK ESYDLVITDV EMLDMDGFQL LQTIGIEMDV PVIMISANDD TESVMKGVRH  120
GALDYLVKPV RIEELKNIWQ HVVRKNLLEQ AKSGTGKVTM DQNSMSSKRQ RDKEKEKEEE  180
TKAQSDEELS APKKHRLVWS KELHNKFVDA LEQLGGGSKA VPKKILEVMN VPGLSRENVA  240
SHLQKFRNLL KKDSKNPEMN LESENNIDPS QPNRHISDLT TLPSNNLGLN NIGDPGMAAL  300
FGSQNQTFSD YLANRRQVHQ NSLLLPHVAD QVRPNVQNLV FGNFPPNPIS TWNSFPRPEL  360
NGMRLHSYVP PSFSAGQTDP STMPVGLVPY SRPPGTFNLV QMLGDGSTQL SQISQPCPLA  420
MLGPSSSQGQ NERRNLVNFN GRGETGGFAF EIRGQITDES SRIGQFVQNQ PSENTERERN  480
GNYNCSSPDD DLSAMVRQAT VYLAFTANLA AFQASLLAVT VASR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17190254164ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259819.11e-94PREDICTED: two-component response regulator ARR14-like isoform X3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548956
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.18e-78response regulator 10